PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010925573.1
Common NameAG2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25868.3 Da    PI: 9.5585
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010925573.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+lyey+
  XP_010925573.1  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYA 58
                    79***********************************************8 PP

2K-box112.93.2e-37771734100
           K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     s++ s++ea+++++qqe+ kL+++i +Lq+++R+l+G++L+s+sl++L+qLe +Lek+++kiR+kKnell+++ie++qk+e elq++n++Lr+k+
  XP_010925573.1  77 SNSGSVSEADSQYYQQESLKLRQQITSLQNSNRNLMGDSLGSMSLRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKRETELQNANMYLRNKI 171
                     444559****************************************************************************************9 PP

           K-box  99 ee 100
                     +e
  XP_010925573.1 172 AE 173
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.174161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-33273IPR002100Transcription factor, MADS-box
CDDcd002651.93E-45271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2884171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.49687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIIFSS RGRLYEYANN  60
SVKATIERYK KACTDTSNSG SVSEADSQYY QQESLKLRQQ ITSLQNSNRN LMGDSLGSMS  120
LRDLKQLEGR LEKGINKIRT KKNELLFAEI EYMQKRETEL QNANMYLRNK IAENEGAQQQ  180
MNMLPATTEY EVMPPYDSRN FLQVNLMQSN QHYSHQQQTA LQLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-21169169Myocyte-specific enhancer factor 2B
1tqe_R1e-21169169Myocyte-specific enhancer factor 2B
1tqe_S1e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001291997.11e-165floral homeotic protein AGAMOUS-like
SwissprotQ407041e-125MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLQ2NNC21e-165Q2NNC2_ELAGV; MADS box transcription factor
STRINGGSMUA_Achr10P21480_0011e-135(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-113MIKC_MADS family protein
Publications ? help Back to Top
  1. Adam H, et al.
    MADS box genes in oil palm (Elaeis guineensis): patterns in the evolution of the SQUAMOSA, DEFICIENS, GLOBOSA, AGAMOUS, and SEPALLATA subfamilies.
    J. Mol. Evol., 2006. 62(1): p. 15-31
    [PMID:16320117]